SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7CAH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7CAH1
Domain Number 1 Region: 38-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000306
Family APH phosphotransferases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7CAH1
Sequence length 314
Comment (tr|D7CAH1|D7CAH1_STRBB) Phosphotransferase {ECO:0000313|EMBL:ADI06528.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_03407 OC=Streptomyces.
Sequence
MVSAPQPGGPEAAPITLPQRLLDSLSNDPQSPARVWLAKLPELVAHQLRGWELTLERVPS
PGGRSSLIVLVRQADGTPATLKFPAPGPYAGHERAALAHWNGWGAVHLLRDDPESGALLL
ERLHSAVSLRSLPEAKALLEAAGTVRRLWVPPAEGHPFDSVATRTGKGVETLRLIAAGTW
AADARPLVDEALELREELSGQTPEHLLLHGDFRQGKVLAGERAPWLAVGPTPLVGERAYD
LAQLVLDRCEDLAAGSGPAAAARRRVAKLADSLDVDRDRLRGWTLFRAVEAGLRHAAVGD
RRRGELLLEFAGWL
Download sequence
Identical sequences D7CAH1
gi|374986164|ref|YP_004961659.1| WP_014176005.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]