SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7CDG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7CDG6
Domain Number 1 Region: 624-708,837-895,938-1123
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-61
Family WD40-repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 7-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-58
Family Protein kinases, catalytic subunit 0.0000876
Further Details:      
 
Domain Number 3 Region: 443-726
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.59e-47
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 4 Region: 302-432
Classification Level Classification E-value
Superfamily TPR-like 0.00000019
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7CDG6
Sequence length 1131
Comment (tr|D7CDG6|D7CDG6_STRBB) WD40 repeat-domain-containing protein-like protein {ECO:0000313|EMBL:ADI13008.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_09890 OC=Streptomyces.
Sequence
MTGETVDGRYRVMGELGRGGMGVVHRVRHLAWGIDMAVKSSRPELFRSPGDQELFVREAE
AWVSLGLHPNVCACHYVRVIDGVPRVFAEYVDGGSLAEWIGDGRLYAGDARQALARVLDT
AVQAARGLEHAHRRDLVHQDVKPANILLDGTGAAKITDFGLARSKAVTAPADLQMAPDVS
VLVPSGGMTVGYASPEQLAGEPVGRRSDVYSFAVSVLEMFTGGVHWAAGSVAGLALEEYL
ADPSNPVAAPPEVAHLLRRCLRQHPAHRPASMADIADVLTGVYEQATGSAYPRPTSQAAD
LRADELNNRGLSLLDLDRAADAEQAFGQALAVDPHHVGAVYNGGLFRWRTGAITDGELVA
RLEAIPRGSGASSWQVQLFLARVHLERGDLAAAHDLLDALARERPDDTDVRAALRVAASG
TVADARRTSTRVFREPFALPFAPVKLLARHEVMGYLPIRFSPDGRLALSGHWDGVLRLWD
TATRAQRLSVRGHRTQVLGVDLTPDGSYALSTSRDGTVQFWDLRAGRCTRVIRSAARATG
CPVRLSADGRIGVWQGVDGRVQVWEPRTGTCQWLLGEAFKGNYLDGSQYEVSADGRHVLT
AEEDGARLWSVADGRCRVLAAGSATHALCFSPDGRMVAVAGEDRVIRLWAVGDDQQVRTL
RTLTGLTAAAGHLAFADSGRLLLSGTTGDHTVQIWELSSGRCLRTFTAHAYGMHHVGFPD
SDDRFGCSVGGHPELPMHRWRLPDPEYAAEPHLIKPREYAEVSRLGGLAEELLAEARQAM
SNGRHRSAFGLLTRAREIPGYERAPQVLAAWHELGRSARHVRLRSAWSRPLDAGHLSFGA
ITAIGVAADVRLAVSGQSDGTVRIWDLDSGACTRVLDDHQGRVGGVALSDDGRYVLCEGT
KPLAIIRRRLADGECRRLTPDWDMRRTIRFTGDGRYAWFGSGDGVLRRWDLDDDRCVATI
PRNGPVNVISTSADGRLAAVGDSNGVVRLRDLDTGACLRTWTGPREPILSACLSADGRLA
MSTHQVMSSGAKDEPIRLWDAGAGQSVREFAGHEGWVSAVRFTPDARFAFSAGHDRSVRM
WEVATGRCLHVLEGHQQRIRHLELTPDLRNLVSAGDDGIRLWDLDWELAAD
Download sequence
Identical sequences D7CDG6
gi|374992644|ref|YP_004968139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]