SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7CEZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7CEZ5
Domain Number 1 Region: 38-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000289
Family APH phosphotransferases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7CEZ5
Sequence length 441
Comment (tr|D7CEZ5|D7CEZ5_STRBB) Uncharacterized protein {ECO:0000313|EMBL:ADI11017.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_07897 OC=Streptomyces.
Sequence
MPTQQTQAEQRGEHILAVFDTAFGELLAADPAAFRVKFRKMAASAFAFYRGTAGLFYADV
EQEREGGPYLDDRTGRVWIHGDLHAENFGTYMDANGRLIFNVNDFDEAYVGPFTWDLKRF
AASVALIGYTKALSDEKISELVRIYAASYRERIHALATGAKNDEVPPFTLETAEGPLLDA
LRDARSLTRFGLLDSMTTIRDFERRFASGGGSVELDAATRYKVLAAFDGYLETLPESSLA
RPDSYRVKDVVGRRGIGIGSAGLPSYNILLEGNSDALENDVVIYMKQAQTPAVSRHITDE
RVRSYFHHEGHRTVISQRALQAHADPWLGWTELDGSGQLVAEISPYAVDLDWSDIDDPAE
IAAVVADLGRATATMHAAADDQSGHSLVPFSTERAIDAVIAADEGGFAELLVDFAHSYGA
RARADHQIFVDLFRNGRIPGL
Download sequence
Identical sequences D7CEZ5
gi|374990653|ref|YP_004966148.1| WP_014180467.1.69245 WP_014180467.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]