SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DBB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7DBB9
Domain Number - Region: 18-110
Classification Level Classification E-value
Superfamily Prefoldin 0.000262
Family Prefoldin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7DBB9
Sequence length 140
Comment (tr|D7DBB9|D7DBB9_STAHD) Uncharacterized protein {ECO:0000313|EMBL:ADI31466.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_0334 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MSAVVREFSSFADLIKSIDEELNMLKQQLADYLRRLEDIRAKSEQERRLRELLKNLTGEE
QTSKGKVVDLKDVKLYVNPDAQQEATVMEEIIDRINKTIQSLQSIRKSLEPLSNVEVEAK
IVVVYKEGAPSSIILKLSST
Download sequence
Identical sequences D7DBB9
gi|297526341|ref|YP_003668365.1| WP_013142664.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]