SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DBW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DBW0
Domain Number 1 Region: 14-77
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000314
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 
Weak hits

Sequence:  D7DBW0
Domain Number - Region: 76-119
Classification Level Classification E-value
Superfamily Prefoldin 0.000628
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7DBW0
Sequence length 127
Comment (tr|D7DBW0|D7DBW0_STAHD) Uncharacterized protein {ECO:0000313|EMBL:ADI31657.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_0526 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MSYWWYRIMKRYRPPPPPPWYAPPYPYQYPYQQQTQPQQQTQQVQQPTQQQWRPPQPPQP
VYQPVPPYFPPPPLPMSPEEELAMLEDYKKALEEDLKELQEELRSVEERIKELRETLKKQ
GGEATYR
Download sequence
Identical sequences D7DBW0
WP_013142855.1.49614 gi|297526532|ref|YP_003668556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]