SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DCA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DCA4
Domain Number 1 Region: 13-195,324-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.29e-62
Family Bacterial dinuclear zinc exopeptidases 0.001
Further Details:      
 
Domain Number 2 Region: 195-322
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.53e-17
Family Bacterial exopeptidase dimerisation domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7DCA4
Sequence length 410
Comment (tr|D7DCA4|D7DCA4_STAHD) Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase {ECO:0000313|EMBL:ADI31801.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_0678 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MPKLPEWIYSLAEEILMESIKYPTVLGEAYEEIVNYYANVLKSHGIHVTIHRVPDEYVKE
KLGPEMNPDKPRYILLARIGESDKVLQFNGHYDVVFPGEGWKITDPFKPLKKNGRIYGRG
STDMKGGIAAFLAAMIYLATTKEEPPISVEAAIVPDEEIGGATGTGYLVNVLGSKPTWAV
IAEPSGLDNIWHGHKGLVWGEIVVKGKQSHGSTPWLGINAFEKMVYVAKYLIENYLPRLK
DKTSRYEYDLPEGKHPTATLGGKLSAPGSINIVPGQVSFSIDRRLIIEENTNDAIEELNK
YIVEAAKKYSADVELRIIERMEPAFTDPSSEIVEALAKAIRMDTGVEPRRTICVGGLDLR
YYSYKGIPVATYGPGEPSMPHKVDEYIEVENLHKVIDVYVDLVNILGRSS
Download sequence
Identical sequences D7DCA4
WP_013142999.1.49614 gi|297526676|ref|YP_003668700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]