SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DWN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DWN6
Domain Number 1 Region: 19-213,314-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000171
Further Details:      
 
Domain Number 2 Region: 197-315
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.53e-31
Family Bacterial exopeptidase dimerisation domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7DWN6
Sequence length 405
Comment (tr|D7DWN6|D7DWN6_NOSA0) Amidohydrolase {ECO:0000313|EMBL:ADI65699.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_4369 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MVSTFPSSSTENLSNVRLQIRSLQPQLIEWRRGIHQKPELGFQEKLTAEFISQKLQAWGV
EHQTGIAETGIVVIIKGEKSQYGKVLGIRADMDALPVQEENEVSYCSQHDGVMHACGHDG
HTAIAMGTAYYLQQHRQDFAGTVKIIFQPAEEGPGGAKPMIEAGVLKNPDVDAMIGLHLW
NDLPVGTVGVRPGPLLAAVDFFNCTILGKGGHGALPHQTIDSIVVAAQIVNALQTIVARN
VNPLDSAVVTIGELHAGTKMNVIAHTARMTGSLRYFNTDLAGFFKQRIEQIIAGVCQSHG
ANYDLEYINLYPAVINNPGIAELVRNVAESVVETPVNIVPECQIMGSEDMSFFLQEVPGC
YFLLGSANAAKNLNYPHHHPRFDFDETALVMGVEMFVRCVEKYFS
Download sequence
Identical sequences D7DWN6
gi|298492645|ref|YP_003722822.1| WP_013192710.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]