SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DXP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DXP4
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.09e-16
Family Antibiotic resistance proteins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7DXP4
Sequence length 124
Comment (tr|D7DXP4|D7DXP4_NOSA0) Glyoxalase/bleomycin resistance protein/dioxygenase {ECO:0000313|EMBL:ADI65870.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_4646 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MQASRYFYGHILGLHELTGEEVPATLVELVNVGKITNFVTPDGTILDLFGEPELFPPDPD
PSKSFTRAYHLAFDIEAELFDQAVSALRENNLVIAHGPVTRSTGRGVYFYDPDGFMIEIR
CAPH
Download sequence
Identical sequences D7DXP4
gi|298492816|ref|YP_003722993.1| WP_013192880.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]