SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DZ02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DZ02
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 4.32e-25
Family Ribosomal protein L31p 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7DZ02
Sequence length 77
Comment (tr|D7DZ02|D7DZ02_NOSA0) 50S ribosomal protein L31 {ECO:0000256|HAMAP-Rule:MF_00501, ECO:0000256|SAAS:SAAS00804274} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_2588 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MAKPDIHPQWYPEAKVYCNGQVVMTIGSTKPELHVDVWSGNHPFYTGTQKIIDAEGRVER
FLRKYGMSGEQSGKNKK
Download sequence
Identical sequences D7DZ02
gi|298491427|ref|YP_003721604.1| WP_013191497.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]