SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7DZE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DZE7
Domain Number 1 Region: 1-65,95-386
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 358-476
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.9e-26
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7DZE7
Sequence length 501
Comment (tr|D7DZE7|D7DZE7_NOSA0) FAD-dependent pyridine nucleotide-disulfide oxidoreductase {ECO:0000313|EMBL:ADI62899.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_0316 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MKIDYDVVIVGGSIIGYYAALTATQLQAKVALVQPQVNYEFNYHYALSEIAKMMQHCLDV
ADLGIITQPDTELNGTNSDTILADKSEISIHQARYINPWKQAIMYADAITTNLNQVNSLA
NLATQGVDVIIGNGEFSSSPQLSFAVNNRILNARTYLLACGSLSKIPDIAGLKTTGYVTL
TNIWQSLEKPNPPKNWVILGGLPQSMEIAQTLARLGCNITLIFNHPSVFSHLDPELAQLL
IAQLEADGVCVLNQIIVTQVRQVEDKKWVQAGDKAIETDEILVATGQQPNIGNLNLTAVG
VKCRPRGLVVNDKLQTTNQRIYACGDVIGGYDIANIANYEAKIAVNNALFFPRLAVNYNY
IPWMISSQPMVAQVGLTELQAKRQYGKQEVLVLRQYFKTLAAAQVQDNITGICKLTSLEN
GKILGCSILGTAAGELINLIALAMSQNLKIQHLAKIAAVYPSFSETLEQTVREWSNIKLS
KNHRLQEFLQSFFHFRRDWNL
Download sequence
Identical sequences D7DZE7
WP_013189919.1.25658 gi|298489845|ref|YP_003720022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]