SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E012 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E012
Domain Number 1 Region: 49-324
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.73e-34
Family TK-like PP module 0.0079
Further Details:      
 
Domain Number 2 Region: 378-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.79e-32
Family TK-like Pyr module 0.013
Further Details:      
 
Domain Number 3 Region: 586-734
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000811
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7E012
Sequence length 737
Comment (tr|D7E012|D7E012_NOSA0) D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase {ECO:0000313|EMBL:ADI66182.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_5099 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTATTTKASSAVPNFCEGIQYFREALPDFDTYGTTPAIASGKVAILNPTDTNAVYQTLLA
ADALRYLTLQITGSKASGHPGGFASQAEAYAALVMLGHKNIITEVGHHAPGFYSAMFLDR
SLEDMGIFTVQQLRDRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMSAALLHREKLF
PFTVGDGGLGEPYIMSSMAHFNTAYPSVTNFLPVLVWNGYSQEHHSMVSQKTNEEMIAYW
QGNGFSEVVLVNAKDFDDQNQDGDYVDSTAFSFDNRLDFTKAVLVGMDKAERSALSGKLT
VFIIKQLKGAGVHALGAKSHNLYPKDTLDAPHIVTALQKRALPVEAWETVRTNAERAGGG
PAAKTAVTEFELPLADLGELPLEEYTVGGKPKVATTAMGRLVGIVGNKDKNFLVTNADGN
EASGIANINQALKINHPTTDDLYNQAPGGQVYEPLSEDACAGLAAGLSLMGARTLWCSYE
SFAINGLPIWQTVTQAMAELRRQTPSTITLFTAGALEQGRNGWTHQRPEIEAYFASLMRT
GNIFLLFPPDANSIQACYDWALRTKNKGIVITASKSPLPVRSTFAQTEKGLIDGAVLLHE
VPGGKTVVFAVIGDMTLIPAFEAAAFLETEGIGVKIVSIINPRRLYRPYDTAWETCSEPD
GGFLSDADFEQLFGGDALIGVTGGAAAMLEPIMLRSNSKRDTFAWKRGETTASAGELMAF
NGLTAEALTKRAIELAH
Download sequence
Identical sequences D7E012
gi|298493128|ref|YP_003723305.1| WP_013193191.1.25658 APC37202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]