SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E1N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E1N0
Domain Number 1 Region: 6-119
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.3e-18
Family Antibiotic resistance proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E1N0
Sequence length 121
Comment (tr|D7E1N0|D7E1N0_NOSA0) Uncharacterized protein {ECO:0000313|EMBL:ADI63257.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_0837 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MQYNNIFITIATVNFDNLVNFYIQLLEQEPKNLIPDVYAEFQISSLCLGIFKPKQNYESE
FAVNTKSSLSLCLEVDNLESAIAHLQSLGYPLPGDISTASHGREIYTYDPDGNRLILHQS
H
Download sequence
Identical sequences D7E1N0
WP_013190275.1.25658 gi|298490203|ref|YP_003720380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]