SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E281 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E281
Domain Number 1 Region: 109-311
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-58
Family BC ATP-binding domain-like 0.00000299
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-27
Family BC N-terminal domain-like 0.0000895
Further Details:      
 
Domain Number 3 Region: 318-387
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 7.22e-18
Family BC C-terminal domain-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7E281
Sequence length 389
Comment (tr|D7E281|D7E281_NOSA0) Phosphoribosylglycinamide formyltransferase 2 {ECO:0000256|HAMAP-Rule:MF_01643} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_0975 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MKTSLQLPQKLMLLGSGELGKEFVIAAQRLGNYVIAIDRYANAPAMQVADCSEVISMLSA
DDLETVVTKHQPDFIIPEIEAIRTEKLQEFEQRGIIVIPTATATNYTMNRDIIRELAHQE
LGVRTAEYRYAFTLEELITVSDEIGFPNVVKPVMSSSGKGQSVVQDRTEVEKAWSYAISN
SRGDSQKIIVEEFINFEIEITLLTIKQWDAPTIFCPPIGHSQERGDYQESWQPANISEDK
ILASQEIAKKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTGMVTLISQNLNEFELH
LRAILGLPIPHIEQLGFSASAVILASEKSDSIAFTGVADALAEKDVDIQLFGKPTAHPYR
RMGVALAKGTDVEDAREKATTAASKVKLI
Download sequence
Identical sequences D7E281
WP_013190377.1.25658 gi|298490305|ref|YP_003720482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]