SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E2J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E2J8
Domain Number 1 Region: 6-200
Classification Level Classification E-value
Superfamily Flavoproteins 1.99e-57
Family NADPH-dependent FMN reductase 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E2J8
Sequence length 216
Comment (tr|D7E2J8|D7E2J8_NOSA0) Arsenical resistance protein ArsH {ECO:0000313|EMBL:ADI65020.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_3362 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTNCNHRARILFUYVSLRERSYSRLLVEEAAKIIEEFGAEVRFFDPCELPIYGSVSDTHP
KVQELRESSMWSEGQVWSSPEMHGNITGIMKNQLDWIPLSIGAFRPTQGRTLAVMQVSGG
SESFNAVNTLRILGRWMRIFTIPNQSSVPKAYQEFNEDGPMKDSAYRDRVVDIMEELYKF
TLLLREQVDYLTDRYSERKEKAGKEAIKLANSALNS
Download sequence
Identical sequences D7E2J8
gi|298491966|ref|YP_003722143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]