SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E2S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E2S6
Domain Number 1 Region: 151-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.02e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0087
Further Details:      
 
Domain Number 2 Region: 3-187
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000669
Family FAD/NAD-linked reductases, N-terminal and central domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E2S6
Sequence length 372
Comment (tr|D7E2S6|D7E2S6_NOSA0) Pyridine nucleotide-disulfide oxidoreductase family protein {ECO:0000313|EMBL:ADI63453.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_1103 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLKKLVLIGGGHSHALVLRLFGNKPLSGVRLALITPDIYTPYSGMLPGHIAGFYSYSQCD
IDLQSLSNFAHAQLCLDHVIGLDLKNRKVLCANQPTVDFDILSINISSTPTKLSVPGAVE
YTIAAKPVAQFLEHWYQLQENAVRNPQKALNIAIVGGGDVELALSILAGVRKLEIYLFQS
SKELMPSHHQSVRRIMRDILSNQDVKLHLGERVCEVVKLINKGLTIKCESGLMVTCDQVF
WVTHASAGSWLKAAGIGTDDQGFILVNDNLQSVTHPHIFAAGDIAKMINYQLPKAGVFAV
HKGNPLYENLRSMILGESLKPYKPQTAYFSLIVTGDGRVLANRAILPLPSHQLWWCWKDC
IDRNFMAQSPHQ
Download sequence
Identical sequences D7E2S6
WP_013190471.1.25658 gi|298490399|ref|YP_003720576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]