SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E303 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E303
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.09e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00041
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.64e-28
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 227-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E303
Sequence length 278
Comment (tr|D7E303|D7E303_NOSA0) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_3429 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MPELPEVETVRRGLNQLTLNEGITGGDILLKRTVAYPFYVSEFIDNLKGSSIKSWHRRGK
YLLAELTPSSTCLGVHLRMTGQLLWLNQNEPLHKHTRVRLFFGEKQELRFVDQRTFGQMW
YVPPGVPVESIIRGLAQLAVDPFSPEFTVEYLANKLQKGRRPIKTALLDQSIVAGLGNIY
ADEALFKSGILPTTLCTDLQKKQVEPLRTAIIKVLSASIAAGGTTFSNFLNVKGINGNYG
GEAWVYKRTGKPCKVCGNVIQRIKLGGRSSHFCSQCQK
Download sequence
Identical sequences D7E303
WP_013192085.1.25658 gi|298492017|ref|YP_003722194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]