SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E4R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E4R7
Domain Number 1 Region: 49-265,295-388
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000000418
Family NHL repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7E4R7
Sequence length 388
Comment (tr|D7E4R7|D7E4R7_NOSA0) NHL repeat containing protein {ECO:0000313|EMBL:ADI65383.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_3874 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLNHLTQDIDPLSIFPNGAKIILGNNITSEQIAIPLAPSPTTMFGPRAACLLSPTGPLWV
SDTGHHRLLGWRNLPTEDNQPADWVIGQPDFYHEGQNAKGTPGKSTVSVPTSICKCGAGL
AVADAWNHRVLIWHNVPEDSNFPADLVLGQANFTDNEHNQGSQQPAANTLHWPYGVFYHQ
GKLFVADTGNRRLLIWNQFPTENGQPADIVLGQPDMIFRNENGGGSPTASSMRWCHDITL
WDNNLVVTDAGNNRVMIWDGIPTENNAPCAVVLGQKNFNFVELNQGVYFPTGSSLSMPYG
VDTAGDWLIVADTANSRLLGWKKRESILLLQGGYADGVVGQDSFKSKSENQNFGPPTRRS
LNWCYGIKVCGEIAVISDSGNNRVLIWR
Download sequence
Identical sequences D7E4R7
WP_013192395.1.25658 gi|298492329|ref|YP_003722506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]