SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E5M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7E5M9
Domain Number - Region: 172-209
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00184
Family Rho termination factor, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7E5M9
Sequence length 218
Comment (tr|D7E5M9|D7E5M9_NOSA0) Uncharacterized protein {ECO:0000313|EMBL:ADI66288.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_5288 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MSAIITNYRQLDVAFLLLNNLRIKLRTAGVRISVRKVGNVHRITVSKQPTVATIEQIVGA
TNAKTETRNLSSNNAISSPTEITSSTDDTRSENGANIAPTVNKEIEDNSVVKVITETLSE
STSPLDESHTGYSKDIICDNTAEIITNSTNFPTPAYSSLEITNISDSPELANLENLQTLT
LKRLRKLAKLHKVPGFSRMKEEKLVTKLHGLAIKELVL
Download sequence
Identical sequences D7E5M9
gi|298501414|ref|YP_003723411.1|NC_014249 gi|298501414|ref|YP_003723411.1| WP_013193297.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]