SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E6C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7E6C4
Domain Number 1 Region: 8-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000326
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E6C4
Sequence length 38
Comment (tr|D7E6C4|D7E6C4_METEZ) Zinc finger C2H2-type domain protein {ECO:0000313|EMBL:ADI73146.1} KW=Complete proteome; Reference proteome OX=644295 OS=107634 / OCM 161 / Z-7303). GN=Metev_0216 OC=Methanosarcinaceae; Methanohalobium.
Sequence
MGDKSEKKENKFECKVCEMTFPTRQDYERHMKKHHESG
Download sequence
Identical sequences D7E6C4
gi|298674192|ref|YP_003725942.1| WP_013193714.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]