SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7EII1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7EII1
Domain Number 1 Region: 699-836
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000607
Family DnaQ-like 3'-5' exonuclease 0.021
Further Details:      
 
Domain Number 2 Region: 37-71
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000628
Family YqbF C-terminal domain-like 0.065
Further Details:      
 
Weak hits

Sequence:  D7EII1
Domain Number - Region: 413-445,502-519
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0628
Family Di-heme elbow motif 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7EII1
Sequence length 851
Comment (tr|D7EII1|D7EII1_TRICA) Uncharacterized protein {ECO:0000313|EMBL:EFA12001.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC006891 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MSEANLNTVLKEIGSQSLEETMSKNESTQNTSLTSASHTTIKELRKIAKEKNIKGYSKMK
KAELLQKIGRCPHERSEINDQPFAFEDSYFTEFSKKSKIKIIETNAEYTKKWKKHKVYYK
VILLKAEEEDSPKSDLSDIIMKKITVIREGLNEMIKIVKEKTNFKEGDLMNIVVNHPDLW
NPISTGLSRTTEIDNLLNNIQSILTSNQDLDIYGCTFHAEVVNMPRGAGSGVKMLNIAED
SRTKKSITRINNKDRLCCPRAVIVGLTYQTNIILGKEFNDNAITYIRKGRNLQTTLAQEL
CNQLGEYNRNYFTLDDIANIERLLNIQIKIVAAECFNSIIYSGPEKDVKVYLYKNGNHFD
TINSMTGFYGQSYYCEKCDKPYQHKDNHKCKKGDKICILCLKPKHEEGSKQRIYCEKCNR
YCFNQECLENHSEVCERFHKCLKCNKILKRGDKMVDEGKKMIEQGNKMIEEGNNKKGNQI
IEKGNKMIEEGCKEHRCGWEICRNCYKEVEILEHKCYMQWIRQKGGRICETIMKDGDNKY
KAKGCTVTFPDETNKQSNKGKETLSLKDLEKGSGYTITDLQLFTKDGKEKAVVILNNEFK
LFLPDRLAKRGDELIDYMLEYDLVMTYNGLIDVKTYKMHDITFKKMDKRPDKTTERIKYY
IYQCKDCKKCVKKPLDDEEPFKCVKCSSKYNTTKSSYTEKYLFFDYEAMQETGKHIANLV
ISHDFNGNVNSFETNEDFCKWLISRDPKGYTAIAHYSKGYDSYFILKYCVENGIKPFCIY
NGSKIMLMEIKSINLRIIDSSNFVQGPLKNFPKTFGLKELKKGYFPHFFNTTENQNYIGK
IPDTNTMVLIL
Download sequence
Identical sequences D7EII1
TC006891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]