SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7KYV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7KYV7
Domain Number 1 Region: 128-383
Classification Level Classification E-value
Superfamily L domain-like 8.33e-30
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-148
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.84e-29
Family Cap-Gly domain 0.0014
Further Details:      
 
Domain Number 3 Region: 441-528
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000315
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7KYV7
Sequence length 531
Comment (tr|D7KYV7|D7KYV7_ARALL) Uncharacterized protein {ECO:0000313|EMBL:EFH65096.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_476275 OC=Arabidopsis.
Sequence
MKAESSNESYKIGQRVHSLNDPRRVGTVKYVGDVEGYSGTWIGVDWDQDGDGKHNGTVNG
VFYFNGRSQSSASFVRSQNLSRGITLLQALELRYRTTSTKDEEDEMYVLSAGNRRVSIQL
LGGDKIQDKLSRFEELTSASLSYLGVSSLGVSSDLSSILPNLKLLDLTGNLISDWEEIGA
LCEQLPALTTLNLSCNSLSSDITSLPQLKNIRVLVLNNSGLSWTQVEILRRSLPGLEELH
LMGNMISALTSTSPSDGQAFNSLRLLNLDDNCISDWSEVLKLSQLPCLEQLYLNKNKLTH
IFHSVNGIESPKKSSDPFPSLRCLLLGANSIGDLASIDALNVFPQLVDIRLSENPISDPV
RGGVPRFVLVARLTKVQVLNGSEVRAREKKDSEIRYVRMVMSKLNDKSEEIELLHPRFYE
LKKLHGIEDERASAENSGPKNMASGLLSIALKCVGPSMGEKPELTKKLPGSITVGKLKIL
CENFFKLKSIKPRLLLQEEGSPFPTALDDETATLLDVGICDGSTLLVDEES
Download sequence
Identical sequences D7KYV7
jgi|Araly1|476275|fgenesh2_kg.2__1405__AT1G71440.1 59689.fgenesh2_kg.2__1405__AT1G71440.1 XP_002888837.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]