SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7L7P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7L7P9
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.64e-31
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 197-307
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000183
Family Calsequestrin 0.075
Further Details:      
 
Weak hits

Sequence:  D7L7P9
Domain Number - Region: 437-566
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000104
Family PDI-like 0.08
Further Details:      
 
Domain Number - Region: 348-411
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0908
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7L7P9
Sequence length 575
Comment (tr|D7L7P9|D7L7P9_ARALL) DNAJ heat shock N-terminal domain-containing protein {ECO:0000313|EMBL:EFH58853.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_478205 OC=Arabidopsis.
Sequence
MVRTRLAISVVLVSTLLLLNVESKSVDPYKVLGVSRDAKQREIQKAFHKLSLKYHPDKNK
NKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGQPGFDSGFPGGNGGYSYSSNGGHGG
GGFNFGGPGGWQNMGGGGGSKSFSFSFGGPSESSFGFGMDDIFSMFSGGSSKGKEQFGGF
GSSSKAESKSKSSTVVPIRTINSQVYKKEILDQGMTWLVLSYLPSQRGTQYHESIIEEVA
ESLQGALKVGRINCETESSLCKQLGIVPRRAPRLFVYSYTSSGKATLAEYTEELVAKKVK
SFCQEHLPRFSKRIDLNTFDVSAVSSQRTPKVMLLSTKKDTPVIWRVLSGLYNGRFVFYN
TEVHDTSDPKIQKLGVDAFPAIVGWLSNGEKQVLKTGITVKNLKSAVQELGKLLEGFEKK
NKKVSSNSQPGQSPSESLETIPLLLRSNFDSICGENTPVCIIGAFRSSHGKEKLQSVMSK
VSQKSLSRRQASTTGSQDTVSYSLLDATKQSAFLSSLDKSEFKTSDKFLIAYKPRRGKFA
TFKGDMTMEEVEKFVAAVLNGDIQFTKTRQKPQIK
Download sequence
Identical sequences D7L7P9
jgi|Araly1|478205|fgenesh2_kg.3__906__AT3G08970.1 XP_002882594.1.15461 59689.fgenesh2_kg.3__906__AT3G08970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]