SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7SVJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7SVJ3
Domain Number 1 Region: 93-192
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-23
Family B3 DNA binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7SVJ3
Sequence length 287
Comment (tr|D7SVJ3|D7SVJ3_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI21292.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_14s0068g01290 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MMEQNEAYALMAGVGGELSFVTVRGDKTHEGSDRSPPTRDLVAASSFGVQGRKRMPRQRR
SSAINLLTFAPSTSPHVPPPPPARAIDRKWLRFLFEKELKNSDVGSLRRMVLPKKSAETH
LPLLEAKEGILITMYDLDGQHVWNFKYRFWPNNNSRMYVLENTGEFVNVHGLQLGDYIML
YHDGQTQSLVIEARKASEKNLHADLSKNIAVSDLFLQDLEANRSNYFLAMDTGTSFVYET
TFSNDSPLDFLGGSMTNYPGGSVSNYSRFGALEGFGSVESLSLDDFC
Download sequence
Identical sequences D7SVJ3
GSVIVT01033007001 XP_002275489.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]