SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7TJ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7TJ25
Domain Number 1 Region: 103-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000144
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 
Weak hits

Sequence:  D7TJ25
Domain Number - Region: 358-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00149
Family Anti-platelet protein 0.051
Further Details:      
 
Domain Number - Region: 220-276
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00528
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7TJ25
Sequence length 485
Comment (tr|D7TJ25|D7TJ25_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI30251.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_08s0007g03860 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MERPEATPSLLLLAISFLCTIKWPQIQTAAATSQELLKGFTATPEPSTSSFQPLLTDPTG
NYSMGFLRVNRTQLALSVLHVPSAEPLWQADMARLARWSESTHFFFNGSLVISDPRTKVF
WSTGTNGDRILLLNTSNLQIQKLDKSPTVLWQSFHFPTNTLVENQNFTVNMSLVSSNGLY
SMRLGEDFIGLYENFKENPDQIYWKHGALEAKAEIVKGQGPIYIRLDSGGFLGMYQIGST
PVDVEAFYSFQHPIAGFRLLRLEPDGNLKGYYWTGSNWVLDYQAIKDQCELPGSCGSYGL
CRPGSGCSCIDNSTEYNSEKECLPPETGNLCSDIEGENKFRVLRRKGIELPYKELMGYET
TSSLEQCERSCENNCSCWGSVYNNASGFCYRVDYPIRTLLGVGDDTKVGYFKVREGPQKK
AESGFGFVIGLLGATVLAFGGVVGFGVYKVWRRKGAKGVSEEAGGVNPGPYKTLGAASFR
SIEMT
Download sequence
Identical sequences D7TJ25
GSVIVT01033786001 XP_002283448.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]