SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7TN49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7TN49
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily PapD-like 1.05e-44
Family MSP-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7TN49
Sequence length 238
Comment (tr|D7TN49|D7TN49_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI31922.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_02s0154g00500 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MSTGELLSIEPLELKFPFELKKQISCSLQLSNKTENHVVFKVKTTNPKKYCVRPNTGIVL
PRSTCDILVTMQAQKEAPSDLHCKDKFLLQSAVVTAGTSQTDITADMFNKDSGHIVEECK
LKVVYVSPPQPPSPVPEGSEEGSSPKGPSTDNGNPSGPEFASVTKALAKSQENSSETRAL
ISKLTEERNNAIRRNSKLRQELDLLKHDGKKNRGGVSFMFVAIVGLIGIIVGYFIKKT
Download sequence
Identical sequences D7TN49
GSVIVT01001317001 29760.GSVIVG00009606001 XP_002270502.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]