SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7TPK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7TPK6
Domain Number 1 Region: 37-136
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7TPK6
Sequence length 363
Comment (tr|D7TPK6|D7TPK6_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI32429.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_03s0063g00630 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MSSCKRIRVDTDHITNGNEAKSSVMERAEKVQRNLPSEIPSMIKSMLPSHVTGGFWLGLP
KKFCDVHLPKYDTTIILVDKRGAEYKTKFLVGKTGLSGGWRGFSIAHNLLEGDVLVFGLV
QPTKFMVYIVRTNGFDEFYIPQENTKKESLSVSTTELGLAACQSENDSDGHGSEVLERIR
FSESAVDFKEVKSMEAFSILVNGLIINSEFSKHLQTKYYELCCSQKTYLHDHLLDGLNYK
LAAGIISETVNIADAIRASKLTTSRDNFSIWSKTLKAFQELGMNVGFLRARLDQLMSFGF
VENRKREARLERVSAEEKIRDLEGSLLHVKEVRKRLNAEIEALDSPAAEKHEMMFQELAK
SSW
Download sequence
Identical sequences D7TPK6
GSVIVT01031762001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]