SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7TVI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7TVI5
Domain Number 1 Region: 108-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-40
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 564-646
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000226
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7TVI5
Sequence length 682
Comment (tr|D7TVI5|D7TVI5_VITVI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_02s0025g01740 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MMVGFGGEGDDLYAELWKACAGPLVDVPRRGERVFYFPQGHVEQLEASTNQELSQRIPLF
NLPSKILCRVIHIQLRAEQETDEVYAQITLLPEPDQAEPRSPDPCTPEPPRPTVHSFCKV
LTASDTSTHGGFSVLRKHANECLPQLDMNQATPTQELVAKDLHGYEWRFKHIFRGQPRRH
LLTTGWSTFVTSKRLVAGDSFVFLRGDNGELRVGVRRLARQQSTMPTSVISSQSMHLGVL
ATASHAVATQTLFIVYYKPRTSQFIIGLNKYLEAVSNGFAVGMRFKMRFEGEDSPERRFS
GTIVGGEDFSPEWKDSEWRSLKVQWDEPASIPRPEKVSPWEIEHYVSSVPQGLAPPGVLK
NKRPRSNESPVPETGSAAASAVWHLGLTQSHDLTQMSSTAEGKRSENHVMWHHKQADIGG
PLINSNTACVSRTQTEGSWLSSSHVSASQHQFQDATEDSKSVSAWPALSGYSTLHSSKLT
SDTIIDPNGNGKKAVAEMATSCRLFGFELMNHSSSPPVGKAHGHSISVSSGTDSDQKSDL
SKASKEQKQGQSHVSPKEIQSKQNCYSNTRSRTKVQMQGIAVGRAVDLTALEGYDELIDE
LEEMFEIKGELRPRYKWEIVFTDDEGDMMLVGDDPWPEFCNMVRRIFICSSQDVKKMSPG
SKLPISSMEGEGTTISLDSTEN
Download sequence
Identical sequences D7TVI5
GSVIVT01019566001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]