SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7UDP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7UDP4
Domain Number 1 Region: 65-205
Classification Level Classification E-value
Superfamily PapD-like 2.15e-33
Family MSP-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7UDP4
Sequence length 264
Comment (tr|D7UDP4|D7UDP4_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI40859.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_00s0203g00040 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MAVPDQRSHSDGKVWGFFKLPFRGNNTITMSSSSTSHSSHLQHHHNQSNMQVEGSNLHPS
GSVSSVARSLLPTRRRLRLDPSNKLYFPYEPGKQVRSAIRIKNTSKSHVAFKFQTTAPKS
CFMRPPGAILAPGESLIATVFKFVEHPENNEKPMEQKSKVKFKIMSLKVKGPMDYVPEMF
DELKDQVAVEQILRVVFLDVERPSPALDKLKRQLAEAEAAVEARKKPPEDAGPRIIGEGL
VIDEWKERRERYLARQQVEGVDSV
Download sequence
Identical sequences D7UDP4
GSVIVT01003659001 XP_002275178.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]