SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8LAW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8LAW2
Domain Number 1 Region: 377-423
Classification Level Classification E-value
Superfamily RING/U-box 6.86e-17
Family RING finger domain, C3HC4 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8LAW2
Sequence length 432
Comment (tr|D8LAW2|D8LAW2_ECTSI) Peroxisome biogenesis factor 10 {ECO:0000313|EMBL:CBN76471.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0000_0057 OC=Ectocarpaceae; Ectocarpus.
Sequence
MEGADPPLLRYAAQPDVVLSQERDLYYANTLLGEGTSELAETLLGARRVMILAPELRALA
SCLYFGLTNLAGKQTLGQEYCGIDLVLSGRGGGRESSPLPRRPLQAYTFLRVAVPYLQER
MREGWHGLRSLRDPFGSGGAAASLAAARARARARAAVAPPVGIAVSSGSGETAADRAGSS
EEEEENVVPTEAAIDVSSGESGGGARAPPLASRSARSSPPPVVSFLRRVLSWARRRRPAM
SGVLEWALRLHLAAFYFDGRFANVGMRTVGARLAYARPEQEAPRARYAVLGLLLLLQAAA
EAATASAETAERWRATARAALSERFPRSTETEAACGEEGGPSDLGEGVGDTALPPRVPAA
KRGRTPADVALFPPSRRRCSLCMSNRENVAATPCGHLFCWECIVGWCQTNPECPLCRQPV
APQSIVCLYQYA
Download sequence
Identical sequences D8LAW2
Esi0000_0057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]