SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8LC67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8LC67
Domain Number 1 Region: 66-136
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8LC67
Sequence length 139
Comment (tr|D8LC67|D8LC67_ECTSI) Uncharacterized protein {ECO:0000313|EMBL:CBN79250.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0010_0200 OC=Ectocarpaceae; Ectocarpus.
Sequence
MTTCPVCGEQVQADLCSLHLDTDCSGGGRKEEVRDEVGSGNGGEADSGKTVPKRDTGSEA
AGGLNALAAELTCPICLCVFEDAHSLPCSHRFCLECILGCFKSSKRQECPLCKIPAWKRD
LTRDVSIQNIIAAYRRMAA
Download sequence
Identical sequences D8LC67
Esi0010_0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]