SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8LFA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8LFA1
Domain Number 1 Region: 626-821
Classification Level Classification E-value
Superfamily Sec7 domain 1.02e-63
Family Sec7 domain 0.00000495
Further Details:      
 
Domain Number 2 Region: 1378-1526,1694-1751
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000144
Family HEAT repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8LFA1
Sequence length 2336
Comment (tr|D8LFA1|D8LFA1_ECTSI) BIG2, ArfGEF protein of the BIG/GBF family {ECO:0000313|EMBL:CBN78826.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0145_0040 OC=Ectocarpaceae; Ectocarpus.
Sequence
MVVAAEAGVHPPPTESDTGTNVSNNDDSSTGQPPSGGEDKLLLAMCRTIRKETGWQERTL
RQACDWATGELEQNQHPGVGMARYYRVVELAMGSKSEDVVEAALGQLHKLIAGGLVRRNT
MTTLKDGSSANLGEILVGVVMETGSRDKTVHGEELRKVALFVHETFLVIDSTANRARYNK
AQARATLDHILQEEPERSEGGEGGRRLDEVSLAGGSGGRRKGREAGAGRRGGGSPRLRVG
GDNVELTVVQRDALMLLSELCDWSLVDERTLSEELGGSGGGGGGGGEKESRVILESKTAA
LELIVSVLQTYGGPRFRALPAAATLVRGELCAALLHHCTSNITGLVSLSLRVFVALIKGF
KNHLKAEIEVFITSIFLRILESEHSAFDHKMLVLEVISGLCRDPLALVEMFINYDCDLQA
IDLFKRIATALAKVAKGRAGSEGASASKKDLEQDRSLQLMGMGGAVAMVSSMVKAADLEE
LYGDMAMVPRRGSASGALRRALVGLGCGVFTRKHESTGCRSCVTIEGEEDEGGADEERSV
DTTPVPSSPALSPLPLSGPLPLSSTWSGGAQRAKHALQRGYSLGGADGGFRATAAEGFED
EGPGRDRGSFRFDSAQVEAMHAFDTKRRVQGEIEAGIVKFNLKPKDGLAYLHSKGHLDSK
DPASVAAFLRAQADRLDKTEIGEFMGRGADHMGGFCVKVLHAYVDGIDFTDMEFDEAIRH
FLSGFRLPGEAQKIDRMMEKFAERFCLQNASVFPNPDTAFILAFSIVMLNTDLHNPSIPD
AKRMTKEGFIRNNRGIDQGKSLPDEFLGGVFDRIERSPISLKEDDQLRRKAEGGGSSATT
SLQELLPFAASAQSLRKLAEHDRERQEMLTSSRALLTRQRGHSSSTPTSYTHLSMEGRGE
GDSGWISQDIAEHVRLMHEITWGPLVSVFSEVLEASESPELIELCLDGVKKAVRIAGGLD
VPVARETLLNALVRFTLLDASRHMKDKNVRCAKVLLSLALTEGNLLKESWGLVLRCISQL
ARLQNTASRLQQDDNLFRVTAAASSNSSSVKGSNSKKQYEAAAAAAAAAAASAKAKRARR
ATTMTATAPSPRALQRGGGGGGGGGITEKAGEKDSAEANGKGGDADASAKQERRAKDSLS
ITLPESSLGSPKKKPSAAAAAAGGETTDWLSDLKIAFGVSTTTTTRKNGSSKDIKAVAGD
ETGTGEGDGGGSAGALDQVMSYVKERDAFLKDRRRKEKESAKGELASFFIGPSREEKERV
VEAANATVVMAQIDQALIDRVFSATQLLNREAMQHFVEQLIQVSQSEIPQLFGRRASTLG
NYQRQEGVLKGGAAKPRVFSMQKLVEVAHLNMDIRSRIEWASLWGILADHFGTVGSISGN
SSVAMYTVDCLRQLALKFLDKDELRDFNFQRVFLGPFATIVRTSRETAVRELVVSCLNNV
ILTKGTLLRSGWKTVLTVLRSAAADTQEEVVQPACLILEGLAGETFPLVQYDFVDLVYTL
LEMAASRFLDVSLVCIGHLRLCARQLAEGGVDVALQRPLPEATISNTGQLPPEVLGAVRA
DYGGGGGRGGGPGSDAGCSENSNTDVDDDDDVDEDRRSRRAARNDAVGHLTLDLDSLDPP
VPPDEAGGAVADPPAAAAAAVAVPTPTATGEDRAGRVSPSSDMWPSSARGKRGSNGVGGV
AAAEGGVGAAEQSRLALQLWWPLLTGLARGAGDPRLDCRAAALSTLQDVLKEFGSAPEFS
LRVWPYLLTRILLPVSRLAEKTTPPLAAPTAPAPPLVSAPSAPSTPSRHSRRQAQPATAT
PSALPSPGSGHLRLGPSSSLSAASGGRVPVARAAAATAAAPGPASRGVLPLDVDSWVHTT
APQLFRAAVAVVSSNAEAAVPLGVPTLLAFFEPHVCCRRHRHSTSNGSSSRFCSVSSNSR
QLGTGVAVNGGREGSGDEGESLARQEQRHQVQEDAGGGGEETGRWWDGEMQAAAAAGAAV
AEEAGVPGDGLMSRLALESLGLLVEGLAGHQQEKLPAAVLAHVCDSLLRMLRRCLPESFG
RAGRVGRDGSGGGGGRQPSQQRRRSRPPRPGLPADGDVHGAVGGKARGGVHSGSAAGPML
VVDDLLEWSGDGDDGPGGGGAAGWDGTALALEFLRREGGNLLVRYFVADGEVQRASLEDH
MWSSADDTAAAAAAAAVPSSSFAPPSPSQHRGGFSAESPSRHTVTSSSFSPTASTGSRAH
QQASTPRSVGSGGARRPLGAAPRLPAAGGLGPQHQQREPVNLVASAEAEVRHLTSAVLLL
LRGLLLLQPAEAFDREAGWLCPRLADLVVVRSLEVRAVVRELLTRMAPLIGVPGEA
Download sequence
Identical sequences D8LFA1
Esi0145_0040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]