SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8LKY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8LKY2
Domain Number 1 Region: 311-375
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000389
Family RING finger domain, C3HC4 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8LKY2
Sequence length 405
Comment (tr|D8LKY2|D8LKY2_ECTSI) Uncharacterized protein {ECO:0000313|EMBL:CBN80115.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0031_0122 OC=Ectocarpaceae; Ectocarpus.
Sequence
MEPKPGIALQTFIFNYKQNAALRQGTGKHEPFQRTFLVAICRKLKATPPQRGREKAPTGR
EGKAQPHPPQYLCKDTRHTLVVVGTSTSESLSLLDISSLQTIAVRPRLDARTRLSFQTSW
TPVDSRQQIPVPNKKMPPYRGGRGGGAAGGVLSRGAVQQDNQMKEILDDITAGTKELAGT
VGMQENSGLDKEVHQKLAEQVQQLAAQNAKLEIKRAATASAMKTLAAEVDKKTAGGAAAA
AAAAADDPPPEEMDMAYFLESMTSKLSSAMEGADEKALESKEYKDLMKMIVATAMDDDDD
IIVPNDNRVSLKCPLTSSTFVDPVKNKVCGHTYGKKAILNHIRVAKNDGGVSCPVAGCSN
KVVKADLVPDKDMMRRLKIEENTQHTQTAQDAEDVEDDDVAESFI
Download sequence
Identical sequences D8LKY2
Esi0031_0122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]