SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8LPN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8LPN1
Domain Number 1 Region: 24-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000542
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 104-164
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000347
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8LPN1
Sequence length 577
Comment (tr|D8LPN1|D8LPN1_ECTSI) Uncharacterized protein {ECO:0000313|EMBL:CBN77336.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0053_0001 OC=Ectocarpaceae; Ectocarpus.
Sequence
MESPLAEVASPPVEEPPGEEPGDAHGDAWSCPICFMWFDMPVSPPCQHTFCAGCLKSVVR
AAAHRQRRSGNTGPSGPACPLCREPFTPEVVQPSARIFEEMLKATVTCRNGDCAAQFCPL
RWKKHQEECPSAVVQCMHHLVGCEWKGARRDLSLHVEGCAYEKIKGLIPRVSASLKQIHA
QVHQLEARVMAQNAAVANTRALLAHQRRAGSVFPAVYALLWRPPNWRLYQSPRPGGGVLS
NVTLICLAPILFLALCGAGVFGGGGGLVVEERAVCLVGVAILGFVALLEHDNESPYHELQ
TPSLLKGLAIGEFLLEGTARSMVYFALKGLPDWKRTAALLFLLAPLFYPTVVQAVHRFEV
QVKNAHNQAQRARAQPPLPPVEPVAVKTHDTVVNGVVRGTTMLLMNPVPALVGEVLAKLG
VFVVSAALGPEKLDAFLEHVWLVMSAGIALDDKARLKKRHDSIFRDLRTPLPNMTDRTTR
RLIAAVCVCLFATIVTFFRDILQMVGYSRLLLSVLDSAHFRWELHIGRVVMGSLQQTRTN
QDPNFARTRARDLLRSRLLLLWVVVGSSFFLLFMLTS
Download sequence
Identical sequences D8LPN1
Esi0053_0001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]