SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8QSV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8QSV0
Domain Number 1 Region: 4-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-31
Family G proteins 0.00067
Further Details:      
 
Domain Number 2 Region: 571-702
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-17
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8QSV0
Sequence length 896
Comment (tr|D8QSV0|D8QSV0_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ37003.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_77824 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
AMENLVSLAEAMQQASSVLLDDNDDSAQYTTFLNVVTIGNTGAGKSAVLNSIIGYTVMPT
GENGATRAPIVVELERDQSEGKGLAVMTEGRARPSSANEIRLSLQSRISRILSSRSSRPE
EIRLRLRSSAAPPLTLIDLPGLASLDDQFVNEYGSHNDAVLLVVVPATSVRDITGSQALK
MARELDPEFSRTVGVISKVDQSASDPKSLAAVQAVLSGQGPSASADITWVALIGQSVSIA
AAHAGSVGTDDSLETAWKAETETLRSILTAAPSTRLGRAALVDVISKQIRKRIRQRLPSL
LSGLEGRQQEVEGELVRLGEQMVETEEGTRALALELCREFEDKYILHINSGETGGWRVIS
SFEGALPNKFKNLPLNDLFDLNYLKKVVVLEADGYQPYLLSPEKGLRELVRRALELAKDP
GKHCVDEVHHVLVDIVAASASSTPGLGRYPPFKREVVAIASAALDEYRTHAKKMVVDLVD
MERSYIPPQHFNRLAQRRIDRLRREEETKTRVSKKAQDAEQVLLNKAAGPPVNQTPPLKS
IKGQSDKDKDSKDGKDGAPSSIAGGEISGVYLMKKSTNKSGWKKRWFVLNEKTNRLGYTK
TPDERLFRGVINLEECAIDDASEKDDDDAPTTKSSKKERASDSSISLAFKITNKVPYKSV
LKAHSSVVLKAESIADKQEWIAKLRNCAQGTQQPPGKSASIVKEPSRAPEPVDTVIRRPA
DPDEDLRFMGQEVRDYVEAVLNSLSANIPKAVVLCQVEKSKDAMLNKLYSSIRQIQELLQ
EDPEVKRRRDKCQRQSQVLNKLTHQLSMHEARVSTVSGYTDTDGYGSPSSSKGAGEEWRV
AFESASTAPPPSKSLSINGRIDRRFTATEENGDIGSSRRSTPSRAAPAPPGSMYRG
Download sequence
Identical sequences D8QSV0
jgi|Selmo1|77824|e_gw1.1.1133.1 XP_002961743.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]