SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8QW50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D8QW50
Domain Number - Region: 139-226
Classification Level Classification E-value
Superfamily PH domain-like 0.000362
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8QW50
Sequence length 752
Comment (tr|D8QW50|D8QW50_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ36170.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_438325 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MAAIHPSPTPQCHPATRSCARWRRSGPSQRQAMVIGYIASFLLGALALGVVEIAVLWYLF
VHKPRHRHKAAAAILPSFSMEADPNSPSKISIEGEIWVASVSPFQVENANSSKLLPKDRK
QKKATEQKNEISVSLKFAKLQDRTLILTGSDGAVSSIQLQGCSVLAVSSTAAETRKWAKK
YPIKVEHSSRTLLGTTVCLLYFKTGWEKETWCEALRAAARKDYGPDDWYSKLKHEFAEYV
TGLKKNYPEVFKAGSSSSKNFRGSAPATKKSMSWKRLLKKKKVDGARTKAVTVQTEDLKP
EEPFLHTSNSYQEIDQAKGESDANHSDSTMEGSSFRNLADATEFGSAEFDVLPAKHLPDS
SVAALNLMLSRLFFDLYHSSDFISVFHTRIQTLLSRIPTPSYISPITCSRVDIGKSCPVV
HGLRALPLSDDTFGVEADIEYTGGAVLTLETRLDMRESRVGVEPKNDTSSAAAATADIIN
KSLETVEDDLEVAGEGSGDQGGSGSAKRKRWSQWKAFLSSVADQVSQVPLTLSMRVVSIK
GTLQLRIKASPSDRIWYSFSSMPALELFPEPSVGDHKITTGPLITYIAERIQILVHETMV
YPNSEDIHIRWMVSDDGNWVQQSAAPFPQNLAETKPPEKPREGSNHRNEASPPEVKDEHE
RLITGESSGGTSELEKPLLDRKIERDHRAAREVAGAMMEGSGDFQGAIDEDSSESKRKKG
TRREKMLSLGKKFEEKTRLFAEKMRERFDKES
Download sequence
Identical sequences D8QW50
jgi|Selmo1|438325|estExt_fgenesh2_pg.C_20683 XP_002962707.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]