SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8QW87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8QW87
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-23
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8QW87
Sequence length 775
Comment (tr|D8QW87|D8QW87_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ36589.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_404739 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MAGKEEAGKRETAAKEGLPRESVTTTLSGMQNQRVLWGDPEIAGYLEKRGGRFTSWKRRY
FVLQGYFLFYFISEQQTETPLGLIPIEGCTIKESADVGGKLRRYVFYLNIGTQHVGFSKT
ETYILAASSRDNLEEWTEKLVLAAESREELHGDLRCARAVVGEIRGLLALSPSEKRLFAS
LHGEEAQALQLELLRANAEMADLRKEIEAVSIEADRQESAVLQQLILWDIMSLTDPGREP
NDDYPTLTRLQDEVRYSDEIYRLLFKKGSLFQGDGLQDLKKECRILLVSFVRQVLDLIEE
HHAKIRAKAPRFSFNVDSGIYEDMFYVKAPVLDDEQATLELLARASKSDDDSDEEHETEE
EFHRRFTVVQPRGSEDSLGRRSSRRQSAIAIPPQTSRKSSGGGSAKQQQQQGGPRPKLFP
EQQRPYQLTRSPSRGWQVTPAGGGSPLSLAPVLRKRTHFYENPNMLGSVVTGRTIADVVE
EGDAATAAAAAAGDQSTSIESMRQRVQKVDPIFTSHFGPETRPPASHIKHDANSTQPVPT
SAPDLPPGFIPPYSRPNVLAYVKGTIPRAKSVRPLRPSEAAALAAAAAGTSSAPGKQSVT
PPRSRPNTPDVAASSSSSTAVAATTGAAAATPPKISERRSISIAPQAVEVSEKAPKPADA
KPRPTVKFGPDSNLGEVASAAASPPRASPPRSRPVVKFADEGDSVITITGPGLVGRASFI
GIEPEALEAGPSYGRIRDFPVVVPSILNSDVGLVFPENTDLFNAPQDNEDEEEGS
Download sequence
Identical sequences D8QW87
XP_002963126.1.77236 jgi|Selmo1|404739|fgenesh2_pg.C_scaffold_2000727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]