SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8R056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8R056
Domain Number 1 Region: 203-440
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-65
Family SSRP1-like 0.000011
Further Details:      
 
Domain Number 2 Region: 551-632
Classification Level Classification E-value
Superfamily HMG-box 1.57e-25
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8R056
Sequence length 647
Comment (tr|D8R056|D8R056_SELML) FACT complex subunit SSRP1 {ECO:0000256|RuleBase:RU364013} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_166865 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MGDAHQFNNILLGGRGGANPGQLKISSKGFSWRKSGGGKVVDVAKDDVKSVSWTRVSRSY
QMSIRLKAGSNVKFTGFREQDVSSLNTFITSNIGVTPQDKPLAVSGRNWGEAELEGNTLS
FVVGGKPAFEICVADISNTQVQGKNDVQMEFHVDDTANEKDTLMEMSFHVPSTNTTFVGD
EERASAQVFCDKILSMADVGPAGGEAVAAFETVNVLTPRGRYLVELHLSFLRLFGASDFK
IQYTSVARLFVLPRSAQSSTYVVITLDPPIRKGQTFYPHIVFQYPSEEITELTPLISDEL
LNTKYKDRLAPQYKGLSYEVFVEILRGLSGAGITKPGTKFRSSQEGYAVRAALKAEEGLL
YPLEKSFFFLPKPPTLIVYEEIDYVEFERHGAAGTSSMSSKNFDLILRLKTDQEHLFRNI
SRNEYHSLFKFISEKGLKILNFQTQGSSAVAEALQGSDDEGVDPHLERIRIARATGDEGD
SDEEDEDFVADKDDEGSPTDDSGEEEEPDASDSGGEQQDERPVKKDKKKVEASQKPAATK
KKKKDEEGDGDKKKKRRKKDPNAPKRALSGFMYFSLAERENLKKSTPGISFKDVAKTLGE
RWKAMSKDEKEPFESQARVDKERYTKQMQGYNKGNAGGSTADDESSD
Download sequence
Identical sequences D8R056
jgi|Selmo1|166865|estExt_Genewise1Plus.C_41144 XP_002964585.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]