SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8R4U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8R4U5
Domain Number 1 Region: 21-115
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.71e-31
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000454
Family Thioltransferase 0.057
Further Details:      
 
Domain Number 3 Region: 409-528
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000043
Family PDI-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8R4U5
Sequence length 537
Comment (tr|D8R4U5|D8R4U5_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ32732.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_407813 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MLRSPITVVLVSVLLIFSIPAESKDLYKILGVDKNADQRAIKKAYHKLSLQYHPDKNKAK
NAQDKFSEISNAYEILSDEKKRKEYDLYGESPPGGGFGGGGGGGGGFGGGGGDPFQRDFQ
QQQHQYGNAQHEYQQRYTFHSDGPNGFSFDGFNFGGFGSYMDDMFGGFFKNSNPGPEFGS
QLQQLSSAEFTRQVLNDSETWLLLFVSSTALDQRTRILEEFAKHMNGVIKVGIINCQSNQ
LLCKQQRVSVLKEPKLYICPWVPSRKRSLVEYTGDWKVKALEAYSVEFLPRLSTRIIGDE
EDIFEKDDNLPRAVLLTKKKETPAMWRALSGIFHQRVVQDISDTLARKFKVTKLPAVVGV
LANSDATILSQGPNIKLDDLKGLLKDLETKNRHVRREKRETKSSDGHSKLTKENFSRLCS
ESALCVIAVTRSKSAEEKAKKILLEVSRKNIQPATRSSSVAVSYVYVDGASQAKFVKAFG
DKRLEKQDPALVAFKFRKKRFATHTGPFTSAAIENFVSEALNGEVQFQNVKKEPLIS
Download sequence
Identical sequences D8R4U5
XP_002966705.1.77236 jgi|Selmo1|407813|fgenesh2_pg.C_scaffold_7000444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]