SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8R7N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8R7N6
Domain Number 1 Region: 33-373
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-86
Family Protein kinases, catalytic subunit 0.000000264
Further Details:      
 
Domain Number 2 Region: 296-316,374-487
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-28
Family Pleckstrin-homology domain (PH domain) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8R7N6
Sequence length 489
Comment (tr|D8R7N6|D8R7N6_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ31911.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_168798 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MAAGEEECAPSTASSCKPGSKLTFRAPQQPYTYQDFAYGRLLGMGSYSKVVRAKKKDSGA
EFALKIMDKKHITKENKVAYVKMERLILDHLDHPGVVRLFFTFQDTHNLYMGLECCHGGE
LFDQIRRKGRLSLEEARFYAAEIVDVLEYIHGQGLIHRDLKPENLLLTADGHIKVADFGS
AKVTTPLQNGLSDAQADDKSCTFVGTAEYVSPEVLNGHPVTIGADLWALGCIIYQMLEGR
PPFKGGSEYLTFQKVLAKDLVIPSHFPSAAKELINKLLNLEPDKRPGAGPAGYAALKSHA
FFSGIEWLKLRQSAAPGLAPSPSSQGGGNGAESDDSENSDWDLAHLGGRVSRLDVSDASS
PMSSSNEPSSPSAVLASAARLLDENVHEPWQKFLFEGETILASSRVRKFRKLSVKKRQLI
LTDRPRLFYVHPIKLVFKGEVPWSRDIYVRVENDLKFCICTPKRTYNLEDTKGQARVWKE
SIEKLVNAK
Download sequence
Identical sequences D8R7N6
jgi|Selmo1|168798|estExt_Genewise1Plus.C_80638 XP_002967312.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]