SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8S445 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8S445
Domain Number 1 Region: 392-760
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.62e-115
Family Oxysterol-binding protein 0.00027
Further Details:      
 
Domain Number 2 Region: 58-100,138-195
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-19
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8S445
Sequence length 1249
Comment (tr|D8S445|D8S445_SELML) Multidrug and toxic compound extrusion protein {ECO:0000256|RuleBase:RU004914} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_417928 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MAAASSSKPSKATGSKVPSFTARNPAAPAAFPDAGDLLAKSPTTKTRKKSHSGDVCASSA
PALAGVLHKWVNYGKGWRPRWFELEDGILFYYKIHGPDKICVHNEQIKASKIIGDESRKL
LKKPKFCSQGEERQHRRTFGEVHLKVCSLRESKSDDRKFYIYTGTKTLHLRAESKEDRTA
WMDALRTSKDLFPKDMSSLSYPPPADNIKISTDALKEHLVKLGVPEQGIKECEKIMMSEF
TKIQHQLRVMQQKRLFLIEKIRLLEADKLELETTVVDEMQNNASAGAGNVVGALKDHGIK
THSFLRLLGADESESDEDIRQEVVEAESDDEDFFDTRESLSEAYLESAVFNTTVELIENE
DVSSNGPSGEDVVYPSVKRRTRLPEPKEVENCVSLWSMIRDNIGKDLSRICLPVYFNEPL
SSLQKCFEDLEYSQLLDRAREYGQKGNRLMRILYVAAFAVSGYASTEGRHCKPFNPLLGE
TYEADFPDKGVRFIAEKVSHHPMVIACHCQGRGWELWGDSTLKSKFWGRSIQLDPVGVLT
LQFDDGETFQWSKVTSSINNIILGKLYVDHYGTMRIQGNRGLSCKLKFKEQSMIDRNPHQ
VQGYVHNEGGDKLASLIGKWDESMYYVLGDPVSNARGYDPMDTATLLWQKNPPAEFPTRY
NLTAFAITLNEITPDLKEKLPPTDSRLRPDQRYLENGEYDLANAEKQRLEQKQRQARKLQ
ETGWTPRWFKRGSDQGTYRFMKTYWEARKLGQWQGSFLFFFSLLPANCIDLRDAARFVGV
ERLPEPANCAGVANSTGASEGMVGLLWEIAAIALPAAFALAADPLSSLVDTMFIGRIGSV
ELAAVGVSISLFNLVSKVFNIPLLTITTSFVAEDKASSLESSFSEEKQASVAKDEDPPQQ
PRVQLPAVSSSLALGLILGLAEAALLAGGSSQVLKIMGVPPHSDMFVPAKQYLLLRSIAS
PAIVVSLAIQGMLGNVVHIALDPVLMFTLRLKVYGAAAATVISDYLILLVLLYKLNQSVV
LFPLRLRWSFFGRFFRSGGLLLLRTIGTLLTMTFATSLAARLGANPMAAHQICVQIWLAA
SLLSDSLALAGQAIVAEGLANAEYDKVKLAAYRVLQIGFGFGVLVCLLLFLVSQWLLRMF
TRDTEVLEIVNIVLPFVIATQPINSLAFVVDGLYFGGSDFAFSAYSTICIGAASLVPLFL
GSLWWGLPGIWIGLSFFMCLRLITGLLRLGTASGPWRFLKGDYKMVLPV
Download sequence
Identical sequences D8S445
XP_002978214.1.77236 jgi|Selmo1|417928|fgenesh2_pg.C_scaffold_36000124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]