SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8SV28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8SV28
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000553
Family Ran-binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 316-586
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000108
Family Plakophilin 1 helical region 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8SV28
Sequence length 690
Comment (tr|D8SV28|D8SV28_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ11724.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_125510 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
VQRVKVYRLNDEGRWDDKGTGHVSVEYLERSDALGMVVIDEEDNNTLLVHRISADDIYRR
QEGRFYCALAQTIISWTDPEIATDLALSFQEAMGCGFIWEQICNVQRSVVHYTNVGVLYR
TILIHCATDDVLHDSGSSEIQQLPGVELSSLPQIVKTIAEVAPPDKDRVASLIMKEQSYI
PKLMELFRLCEDLENVENLHMIFRIVKGMISLNDKNVFDTIFSDEHVMDVVGALEYDPEL
SSQQDHRGFLKTQVVFKEAVPIHDVAIVSKIHQTYRIGYVKDVILPRVLDDQTFANMNSM
MLANNKAVVSALHSDKTFVSDLFAKLRSPDISQNVRNDLIYFLHEFCNLSKNLLSLHRSE
LFGSLVEKGIFEVVTMALQSEDLNLRVSGSDILIVILNHDAALLRTFLVQQEGHVLFGLL
VKGLLNSSEGGLQAQILEIMRMLLDSEPSEQPTEKIAYLEMFYEKYIDQLVEVLTSSCPT
KVVTEHSKRVPTVEKTPASGEVLGNICELMCFCVLHHGYRMKYYVMRNNVVEKVLRLVRR
KEKVLVVAAVRFLRTCVGLKDNFYARYLIKNNLFEPVIQAFLANGNRYNLLNSSVLELLD
FIRKSNLKDLLIHIVENYGKKLECVDYVDTVKQLKVKYDQYMDDSTTSDRFIGPLPSLRK
RKDERALDKAEEDYFNEDRYVLLYFIGTGF
Download sequence
Identical sequences D8SV28
jgi|Selmo1|125510|e_gw1.79.108.1 XP_002987148.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]