SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8T0J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8T0J5
Domain Number 1 Region: 241-324
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.17e-25
Family Vacuolar sorting protein domain 0.0078
Further Details:      
 
Domain Number 2 Region: 17-104
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000443
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8T0J5
Sequence length 399
Comment (tr|D8T0J5|D8T0J5_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ09914.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_129274 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MGSGSRWAERLLESGALSESGRPLLGPGEVECQLLDGVDIEVVDSGVEGDPLRSGLLILT
NARMFWVHQHSRSAFFLPLSSVSRISAPRKGLKSVFSSTLRLRGAAAAHSSVTLLLSFRG
HASSFDNLVSQLGAVLQSRAWETLPAAAVNPSTASASTPSSHWNPSRAGVSGILRKEQEQ
WEQTDKNLQEAFHDLNALMGKAKEMVLLADKMRARLLTEGSASGSQQELHDLLLSVGIAS
PVTKESAGALYHQQLSRQLADFVGSPLQSAGGMLALVDVYCLFNRARGTELISPEDLLQA
CDLWDRLDVPVMLRRFDSGALAIQIKSKSDDEVVARIMRLVGDLRTGVGAREAAKCLGVA
PALAKEHLFSAEARGFLCRDDGPDGLRFYTNFFKDAQFP
Download sequence
Identical sequences D8T0J5
XP_002989120.1.77236 jgi|Selmo1|129274|e_gw1.93.188.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]