SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8UAP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8UAP4
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.54e-74
Family ETFP subunits 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8UAP4
Sequence length 263
Comment (tr|D8UAP4|D8UAP4_VOLCA) Uncharacterized protein {ECO:0000313|EMBL:EFJ43140.1} KW=Complete proteome; Reference proteome OX=3068 OS=Volvox carteri f. nagariensis. GN=VOLCADRAFT_96652 OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
MKVLVAIKRVIDYAVPVRVKPDKSGVEALIPKMSMNPFCEIALEEAVRLKEKGVAGEVVA
VSLGPQHFQETLRTALAMGADRAVHVSSEACGLSAQGGEQPQPLGVARVLAALAKRENAG
LVLLGKQAIDDDCNQTGQMVAGLLGWPQATFASKLEAAKGDPRVRVTREVDGGLEVLSLP
LPAVVSADLRLNTPRFVTLPAMMRAKKRPIESATLEQLGLSAADVAPQLRTVVVEEPPRR
KAGSRVADVGELVRRLREEARVL
Download sequence
Identical sequences D8UAP4
XP_002955715.1.37214 jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024 Vocar20006415m|PACid:23128420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]