SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8UJC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8UJC8
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.57e-63
Family N-type ATP pyrophosphatases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8UJC8
Sequence length 225
Comment (tr|D8UJC8|D8UJC8_VOLCA) Uncharacterized protein {ECO:0000313|EMBL:EFJ40149.1} KW=Complete proteome; Reference proteome OX=3068 OS=Volvox carteri f. nagariensis. GN=VOLCADRAFT_32944 OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
MRVVALVSGGKDSCYSMQLCKQHGHDVVALANLLPEESAPDELDSFCFQTVGHQLIGAYA
ACMGIPLFRKRISGTSSVQDLGYTPTEGDEVEDLYQLLAYVKENVPGIQAVASGAIASDY
QRLRVENVCSRLNLVSLAYLWHQPQRLLLRGMVESGVEAILVKVACLGLHPRKHLGRTIA
AMEPALLSLADAYGCNVCGEGGEYETLTLDCPVFTRGSIVLDEFE
Download sequence
Identical sequences D8UJC8
jgi|Volca1|32944|gw1.104.9.1 XP_002958759.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]