SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8UMX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8UMX4
Domain Number 1 Region: 72-214
Classification Level Classification E-value
Superfamily Sortase 0.000000000000785
Family Sortase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8UMX4
Sequence length 215
Comment (tr|D8UMX4|D8UMX4_VOLCA) Uncharacterized protein {ECO:0000313|EMBL:EFJ38925.1} KW=Complete proteome; Reference proteome OX=3068 OS=Volvox carteri f. nagariensis. GN=VOLCADRAFT_101521 OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
MGALAAVAVLFLTACGTPTPSTAPSASSETSDSIPSVQQTQPSMPPAEPSAPPVEVKLRG
TTPTQPAATPPPVSLQVAGTSIDMGVVPVGVAPGGAMEIPETFYEAGWYRFGPAPGAAEG
SAVLAGHIDTTSDQAPFSQLKSLPAGTLITVGREGAPALNYRVVSVTLMAKDAFDGESLF
RRTGPHELKVVTCGGRWLDERMDYSDNVIVTAVLE
Download sequence
Identical sequences D8UMX4
XP_002960010.1.37214 jgi|Volca1|101521|fgenesh4_pg.C_scaffold_2067000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]