SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8V8R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8V8R0
Domain Number 1 Region: 45-359
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-51
Family Duffy binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8V8R0
Sequence length 394
Comment (tr|D8V8R0|D8V8R0_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ACY01453.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
FNDMQEIANNKDNEKETFNTIIEKVKIPAELEDVIYRLKHHEYDKGNDYICNKYKNIHDR
MKKNNGNFVTDNFVKNSWEISNGVLIPPRRKNLFLNIKDTQICQYKRDPKLFKDFIYSSA
FTEVERLKIVYGEAKTKVAHAMKYSFADIGNIIKGDDMMENNSSDKIGKILGGDGDRKNE
KRKAWWDMNKYHIWESMLCGYKQAGGYKETVEKLSEKKQKCTFPDIESVPQFLRWFQEWT
ENFCTKRKELYEDVQKICASAECNTSNGSVDKAECTKTCVNYKNYVLSKKQNMKYKRTNM
IQNLKTKMVIIKDAPDYLKEKCNDNKCECLNKHIDDKNKTWKNPYETLEDTFKSKCDCPK
PLPLFSDNTSDILQKTIPFGVALALGSIAFLFMK
Download sequence
Identical sequences D8V8R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]