SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9CJ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9CJ68
Domain Number 1 Region: 196-273
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 121-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 290-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 457-497
Classification Level Classification E-value
Superfamily WW domain 0.000000000148
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9CJ68
Sequence length 499
Comment (tr|D9CJ68|D9CJ68_VOLCA) CRB1m {ECO:0000313|EMBL:ADI46928.1} OX=3068 OS=Volvox carteri f. nagariensis. GN=CRB1m OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
MSEEYCTTALVPELEGQGRKQFTFGNKTEQLGGCETSGTAETSSVAEAILDAGRNRALEL
ASLFAAQAGQAIGIHAEGMKRKRDDGASLEAPDLKRPAGDVASLKLADDIPLAASFVAPG
TESIASETLSCPTDKVGRIIGRAGATIRELEASTNTRIQVDHKALGDKPVIISGRRDDVE
NAKRVVQDLICGSNEAVPPGTGEVQETVECPPGIVGRVIGRGGETIRTLQQASGAHILVN
QDFPDGVPRQIVITGAQDAVQRATSMVSELIQGDQGNTQSIIQRFGVGSTEVVECPKAMV
GRVIGKGGETIKDLQKRFSASIQIDQGSTPCKITITGPAQTVSSARRAIEDLIRAATVQP
SGGTRSAPPYNTSYAHQPFNGNGPSGAYGPYGGYNLPPTAYTAPSGYPPYGGYPPYPTTG
TPYGAYASFGGAADPFTSGSSLSHQHYATSGIPQQNVAPAQQLASLGSIWQVLQDDQGRS
YYYNTQTGVSQWEKPVDLP
Download sequence
Identical sequences D9CJ68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]