SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9IWB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9IWB9
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.14e-19
Family Hormone receptor domain 0.00037
Further Details:      
 
Domain Number 2 Region: 81-351
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000549
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9IWB9
Sequence length 393
Comment (tr|D9IWB9|D9IWB9_PIG) Vasoactive intestinal polypeptide receptor 1 transcript variant 1 {ECO:0000313|EMBL:ADK12641.1} OX=9823 OS=Sus scrofa (Pig). GN=VPAC1 OC=Sus.
Sequence
MWDNLTCWPATPRGQVVVLACPLIFKLFSPTQGLNVSRNCTDEGWTPLEPGPYPIACGMD
DKASGLDEQQQTVFYNSVKTGYTIGYSLSLAALLVATAILSLFRKLHCTRNYIHMHLFIS
FILRATAVFIKDLALFDSEESDHCSKGSVGCKAAVVLFQYCVMANFFWLLVEGLYLHTLL
AVSFFSERKYFWGYIFVGWGVPSTFIMVWTIVRIHFEDYGCWDTIHSSLWWIIKAPILAS
ILVNFILFIRIIGILVQKLRPPDVGKSDNSPYSRLAKSTLLLIPLFGVHYIMFAFFPDNF
KAEVKMVFELIVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHQQGVLGWDSKYQHPSGG
SNGATCSTQVSMLTRVSPSARRSSSFQAEVSLV
Download sequence
Identical sequences D9IWB9
ENSSSCP00000012026 XP_005669454.1.46622 ENSSSCP00000012026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]