SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9PZV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9PZV3
Domain Number 1 Region: 53-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000218
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9PZV3
Sequence length 310
Comment (tr|D9PZV3|D9PZV3_ACIS3) Beta-ribofuranosylaminobenzene 5'-phosphate synthase {ECO:0000256|PIRNR:PIRNR004884} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0184 OC=Acidilobus.
Sequence
MRAEVETGSRLHGGFYYAAGDWNVRWGSIGFYVDNPKFRAAVELSDREQYRGPQELLEYV
KKAAKVAGVQGFNVEVHESPPIHRGFGTGTQVLLSLYMAFKALKGEQPEAVEEAALKLGR
SRHSGAGTLAFKYGGFVMDAGLPGRPTPLVTLKMPSEWRFVIIIPKIERGLTDEEEESIM
EKRQWGNSESNIAFMTSGALRLAAGIARGDLDDALEGLRFVQRGTGILFASVQGGEYRGK
LNDLAAEAWRSRVILAQSSWGPAMYTIVENEYEAQGDVMLMKEIMSNVGLSGEVIISPPR
NYGASIKIVG
Download sequence
Identical sequences D9PZV3
WP_013266103.1.78912 gi|302347984|ref|YP_003815622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]