SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9Q000 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q000
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 9.68e-16
Family Ribosomal protein L29 (L29p) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9Q000
Sequence length 86
Comment (tr|D9Q000|D9Q000_ACIS3) 50S ribosomal protein L29 {ECO:0000256|HAMAP-Rule:MF_00374} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0231 OC=Acidilobus.
Sequence
MAKYRLSPDDLRKRSLEELTKLLQEQRSELTSLRQKALSGSIDSPAKIREIRKNIARILT
VMNELSRKSQQTKTVAGTANSQQGQG
Download sequence
Identical sequences D9Q000
gi|302348031|ref|YP_003815669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]